Kocuria sp. KD4: HBK84_05580 Help Entry HBK84_05580       CDS       T06521                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kod  Kocuria sp. KD4 Pathway kod01100   Metabolic pathways kod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kod00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HBK84_05580    00074 Mycolic acid biosynthesis     HBK84_05580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HBK84_05580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIR69595 LinkDB All DBs Position complement(1209257..1209502) Genome browser AA seq 81 aa AA seqDB search MASKDEILAGLAEIVNEETGLETDAVQLDKSFTEDLDIDSISMMTIVVNAEEKFDVTIPD EEVKNLKTVEDAVNFIDNAQD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcgagcaaagacgaaatcctggccggcctggcagaaatcgtgaacgaagagaccggc ctcgagaccgacgccgtgcagctcgacaagtccttcaccgaggatctggacatcgactcc atctccatgatgaccatcgtggtcaacgccgaggagaagttcgacgtcaccatcccggac gaagaggtcaagaacctgaagaccgtcgaggacgccgtcaacttcatcgacaacgcccag gactga

DBGET integrated database retrieval system