Klebsiella michiganensis E718: A225_2312 Help Entry A225_2312         CDS       T02173                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism koe  Klebsiella michiganensis E718 Pathway koe01100   Metabolic pathways koe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:koe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A225_2312    00074 Mycolic acid biosynthesis     A225_2312   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A225_2312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AFN31916 LinkDB All DBs Position 2447086..2447322 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactactgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system