Klebsiella michiganensis E718: A225_2346 Help Entry A225_2346         CDS       T02173                                  Name (GenBank) Ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism koe  Klebsiella michiganensis E718 Pathway koe00030   Pentose phosphate pathway koe00051   Fructose and mannose metabolism koe00710   Carbon fixation by Calvin cycle koe01100   Metabolic pathways koe01110   Biosynthesis of secondary metabolites koe01120   Microbial metabolism in diverse environments koe01200   Carbon metabolism koe01230   Biosynthesis of amino acids Module koe_M00004   Pentose phosphate pathway (Pentose phosphate cycle) koe_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:koe00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     A225_2346    00051 Fructose and mannose metabolism     A225_2346   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     A225_2346 Enzymes [BR:koe01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      A225_2346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Gly_rich_SFCGS Motif Other DBs NCBI-ProteinID:  AFN31943 LinkDB All DBs Position 2483949..2484407 Genome browser AA seq 152 aa AA seqDB search MKTIAIGADDAAYAFRDAIVAYLNGQGIKVADYSSDKRQGSMVYPDVAHAVAMSIKQGEH DRGILICGTGIGMSIVANKVPGVRAAQCHDTFSAERARKSNNAQIITLGARVIGPELGKK IIQAWLESEYEGGGSASKVERIDYYEHQHARD NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgaaaacaatcgctattggtgcggatgatgccgcctatgcttttcgcgacgctatcgtc gcttatctgaatgggcagggaattaaggtcgcggattacagcagcgataaacgccagggc agcatggtctatccggatgttgcccacgcggtggcaatgtcaataaagcagggcgagcac gatcgcggcatcctgatttgcggcacaggcattggaatgagcattgtggcaaataaagtg ccgggggtacgagccgcccagtgccacgatactttctccgccgagcgggcgcgcaaaagt aataacgcgcagattatcactcttggcgcgcgcgtgattggcccggagttgggcaaaaaa attattcaggcctggcttgaatccgaatatgaaggcggcggctccgcgtcgaaagtggag cgtatcgactattacgaacaccagcacgccagagattaa

DBGET integrated database retrieval system