KEGG   Klebsiella michiganensis E718: A225_4172
Entry
A225_4172         CDS       T02173                                 
Name
(GenBank) NADH-ubiquinone oxidoreductase chain J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00190  Oxidative phosphorylation
koe01100  Metabolic pathways
Module
koe_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A225_4172
Enzymes [BR:koe01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     A225_4172
SSDB
Motif
Pfam: Oxidored_q3 DUF2109 Frizzled
Other DBs
NCBI-ProteinID: AFN33497
LinkDB
Position
complement(4408634..4409188)
AA seq 184 aa
MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAIAGVFFSLGAYFAGALEIIVYA
GAIMVLFVFVVMMLNLGGSEIEQERQWLKPGIWIGPAILAAVLLVVIVYAILGINDQGID
GAAINAKEVGIALFGPYVLAVELASMLLLAGLVVAFHIGREERVGEVLSNRPNDSDKRKT
EEHA
NT seq 555 nt   +upstreamnt  +downstreamnt
atggaattcgctttttatatctgtggcctgatagccatcctcgcaaccctgcgggtgatc
acccacaccaatccggtgcacgcgctgctgtacctgatcatttcgctgttggcgatcgcc
ggggtgttcttctccttaggggcttatttcgccggtgcgctggaaattatcgtctacgcc
ggggccatcatggtgctgttcgtgttcgtggtgatgatgctcaacctgggtggcagcgaa
atcgagcaggagcgccagtggctgaaacctgggatctggatcggtccggccattctcgca
gcggtactgctggtggttatcgtttacgccatccttggtattaacgatcagggtatcgac
ggcgcggcgattaacgccaaagaggtcggtattgcgctgtttggtccgtacgttctggcg
gtggagctggcctccatgctgctgctcgcgggcctggttgttgccttccatatcggccgt
gaagagcgcgtcggggaagtgctgagcaaccgtccgaacgacagcgataaaagaaaaacg
gaggaacacgcatga

DBGET integrated database retrieval system