Klebsiella michiganensis E718: A225_5462 Help Entry A225_5462         CDS       T02173                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism koe  Klebsiella michiganensis E718 Pathway koe01100   Metabolic pathways koe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:koe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A225_5462    00074 Mycolic acid biosynthesis     A225_5462   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A225_5462 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFN34568 LinkDB All DBs Position 5688972..5689229 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLDELSVDDIETEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFIHAQRT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctgatcataaatacactgaacctggacgaa ctgtccgttgacgatatcgaaaccgaagcggcgctgtttggcgatggtttgggactggac tcaatcgatgctctggaactgggtctggcagtgaaaaaccagtacggtgtggtgctgtcc gccgagagtgaagagatgcgtcagcactttttctccgttgccacgctggcatctttcatt cacgcgcaacgtacctga

DBGET integrated database retrieval system