Klebsiella oxytoca KONIH1: KONIH1_27500 Help Entry KONIH1_27500      CDS       T03269                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kok  Klebsiella oxytoca KONIH1 Pathway kok01100   Metabolic pathways kok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KONIH1_27500    00074 Mycolic acid biosynthesis     KONIH1_27500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KONIH1_27500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AID92713 LinkDB All DBs Position 5732452..5732709 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLDELSVDDIETEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFIHAQRT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctgatcataaatacactgaacctggacgaa ctgtccgttgacgatatcgaaaccgaagcggcgctgtttggcgatggtttgggcctggac tcaatcgatgctctggaactgggtctggcagtgaaaaaccagtacggtgtggtgctgtcc gccgagagtgaagagatgcgtcagcactttttctccgttgccacgctggcatctttcatt cacgcgcaacgtacctga

DBGET integrated database retrieval system