Klebsiella michiganensis M1: HR38_06065 Help Entry HR38_06065        CDS       T03349                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism kom  Klebsiella michiganensis M1 Brite KEGG Orthology (KO) [BR:kom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:kom03110]     HR38_06065 Enzymes [BR:kom01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      HR38_06065 Chaperones and folding catalysts [BR:kom03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     HR38_06065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Motif Other DBs NCBI-ProteinID:  AIE68033 UniProt:  H3N5E0 LinkDB All DBs Position complement(1258680..1258961) Genome browser AA seq 93 aa AA seqDB search MAKSAAALHILVKEEKLAQEILAKLERGVSFDHLAKRYSKCPSGRNGGDLGEFNQGVMVG PFDKAVFSCPLLKPYGPVKTKFGYHIIKVLYRR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcaaagagcgcagcagccctgcatatcctggtaaaagaagagaagctggcgcaagag atcctcgccaaactggaacgtggcgtgagcttcgatcatctggcaaagcgctattcaaag tgcccatccggacgcaacggcggcgatctcggggagtttaatcaaggcgttatggtcggg ccgttcgataaagcggtcttcagctgcccgctgctaaagccatatggaccggtcaaaacc aagttcggctaccacatcattaaggtgctgtatcgccgctag

DBGET integrated database retrieval system