Klebsiella michiganensis M1: HR38_08995 Help Entry HR38_08995        CDS       T03349                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism kom  Klebsiella michiganensis M1 Pathway kom03030   DNA replication kom03430   Mismatch repair kom03440   Homologous recombination Brite KEGG Orthology (KO) [BR:kom00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     HR38_08995    03430 Mismatch repair     HR38_08995    03440 Homologous recombination     HR38_08995  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kom03032]     HR38_08995    03400 DNA repair and recombination proteins [BR:kom03400]     HR38_08995 Enzymes [BR:kom01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      HR38_08995 DNA replication proteins [BR:kom03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      HR38_08995 DNA repair and recombination proteins [BR:kom03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      HR38_08995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_III_psi CSTF_C Motif Other DBs NCBI-ProteinID:  AIE68570 UniProt:  A0A0J2H0K4 LinkDB All DBs Position 1868465..1868878 Genome browser AA seq 137 aa AA seqDB search MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPGHIRLVMVAEEPPSLTEPLISDILRA LALMPEQVMQLTPERVAMLPQDARCNSWRLGTDAPLLLAGAQLSTPAFDELQTSTPARMA LWQQICAHEHDFYPQPG NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgacatcccgacgagactggcaattacagcagctgggcatcacccagtggtcgttacgt cgtcctggggcgttacagggtgaaatcgctatctcgcttcctggacatattcgtctggtg atggtggcggaagaaccgccatcgctgaccgaaccgctaatcagcgatattctgcgcgcg ctggccctgatgccggagcaggtgatgcagctgacgcctgaacgcgttgcgatgctgcct caggacgcacgctgtaatagctggcggctgggcaccgacgcgccgctgctgctggcgggc gcacagctttccacgcccgctttcgatgaacttcagaccagcacgcctgctcgcatggcg ctctggcaacagatttgcgcacatgaacacgatttctaccctcaacccggctga

DBGET integrated database retrieval system