Kosakonia oryzae: AWR26_01410 Help Entry AWR26_01410       CDS       T04433                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kor  Kosakonia oryzae Pathway kor01100   Metabolic pathways kor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWR26_01410    00074 Mycolic acid biosynthesis     AWR26_01410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWR26_01410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANI80864 UniProt:  A0AA94H8A2 LinkDB All DBs Position complement(312125..312382) Genome browser AA seq 85 aa AA seqDB search MQQLYLEIKNLIISTLNLDELSADDIETESALFGDGLGLDSIDALELGLAIKNQYAVVLS AESEEMRQHFYSVATLASFIQSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaacagctctatcttgaaattaaaaatcttattatcagcacattgaatctggatgaa ctcagcgccgatgacatcgaaaccgagagcgcgctcttcggcgatgggctgggactggac tccatcgatgcgctcgaactgggtctggcgatcaaaaatcaatacgcggtggtactttca gcggaaagcgaagagatgcgccagcatttctactctgtcgccacgctggcatcttttatc cagtctcaacgcgcataa

DBGET integrated database retrieval system