Kordia sp. SMS9: KORDIASMS9_00697 Help Entry KORDIASMS9_00697  CDS       T05562                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism kos  Kordia sp. SMS9 Brite KEGG Orthology (KO) [BR:kos00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kos03032]     KORDIASMS9_00697    03036 Chromosome and associated proteins [BR:kos03036]     KORDIASMS9_00697    03400 DNA repair and recombination proteins [BR:kos03400]     KORDIASMS9_00697 DNA replication proteins [BR:kos03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KORDIASMS9_00697 Chromosome and associated proteins [BR:kos03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KORDIASMS9_00697 DNA repair and recombination proteins [BR:kos03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KORDIASMS9_00697 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 PqqD Gasdermin Ldh_2 Motif Other DBs NCBI-ProteinID:  AXG68482 UniProt:  A0A345GVZ4 LinkDB All DBs Position 740778..741068 Genome browser AA seq 96 aa AA seqDB search MTKADIVAKISEKLGMEKSEVQATVETFMEEVKNSLESGDNVYLRGFGSFIIKTRAEKTG RNISKNTTIKIPAHNIPAFKPAKIFVEGVKDNVKVK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagcggacatcgtagcaaagatttcagaaaagttaggaatggagaagagtgaa gtacaggcaactgtagaaacttttatggaagaagtaaagaattcacttgaaagtggagac aatgtttacttaagaggttttggtagctttattatcaaaacgagagcagagaaaacaggt agaaacatctctaagaacacaactatcaaaattcctgcacacaatattccagcattcaag ccagcaaaaatctttgttgaaggagtgaaagacaacgttaaagtaaaataa

DBGET integrated database retrieval system