Kosakonia sp. CCTCC M2018092: EH164_13960 Help Entry EH164_13960       CDS       T05734                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism kot  Kosakonia sp. CCTCC M2018092 Brite KEGG Orthology (KO) [BR:kot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kot03400]     EH164_13960 DNA repair and recombination proteins [BR:kot03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     EH164_13960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Cutinase Motif Other DBs NCBI-ProteinID:  AZI88102 LinkDB All DBs Position 2916200..2916445 Genome browser AA seq 81 aa AA seqDB search MRIEVTIARTTSLPAGAIDALAGELSRRLNDHYPDRENKISVRYAAANNLSVLGGAKEDK DRVTEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaagtgacgattgccagaaccacatctttacccgcgggcgctatcgatgcg ctggcaggtgagttatcccgccgtctgaatgaccactatcccgatcgcgaaaataaaatt tctgtccgttatgcggcagcaaataatctctccgtccttggcggcgcgaaagaagataaa gaccgcgttaccgaaatcctgcaagagacctgggaaagcgctgacgattggtttatcacc gattaa

DBGET integrated database retrieval system