Kosakonia sp. CCTCC M2018092: EH164_14275 Help Entry EH164_14275       CDS       T05734                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kot  Kosakonia sp. CCTCC M2018092 Pathway kot01100   Metabolic pathways kot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EH164_14275    00074 Mycolic acid biosynthesis     EH164_14275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EH164_14275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AZI88153 LinkDB All DBs Position complement(2985694..2985975) Genome browser AA seq 93 aa AA seqDB search MTVMQSKIEERKEVLFTIKTEIIQRLNIPREPSQIDDDTPLFGNGLKLDSVDATEIIVML DKVFDIQVSESDNPSYMRSINSLASFVITKRQA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacagtaatgcagagtaaaattgaagagcgtaaagaggttctcttcaccatcaaaaca gagatcatccagcgtttaaatattcctcgtgaaccatcgcaaattgacgatgatacaccc ttatttggcaacggcttgaaattagattcggtcgatgcgaccgagattattgtaatgctg gacaaggtttttgatattcaggtgagtgaaagcgacaatccgtcttatatgcgtagcatt aacagccttgcttcttttgtgataacgaaacgtcaggcttaa

DBGET integrated database retrieval system