Kosakonia sp. CCTCC M2018092: EH164_16970 Help Entry EH164_16970       CDS       T05734                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism kot  Kosakonia sp. CCTCC M2018092 Brite KEGG Orthology (KO) [BR:kot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kot03032]     EH164_16970    03036 Chromosome and associated proteins [BR:kot03036]     EH164_16970    03400 DNA repair and recombination proteins [BR:kot03400]     EH164_16970 DNA replication proteins [BR:kot03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EH164_16970 Chromosome and associated proteins [BR:kot03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EH164_16970 DNA repair and recombination proteins [BR:kot03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EH164_16970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AZI88643 LinkDB All DBs Position complement(3560215..3560487) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAFMASVTESLKSGEEVALVGFGSFGVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgatagacaagattgccgctggcgctgatatttctaaagctgcc gccggacgcgcgttagatgcgtttatggcttctgttactgaatctttgaaatccggggaa gaggtagcattggttggtttcggttctttcggggttaaagagcgtgctgcccgtaccggc cgcaacccgcaaaccggcaaagagattactattgctgctgccaaagtccctggcttccgc gcaggtaaagcgctgaaagacgccgtgaactaa

DBGET integrated database retrieval system