Kovacikia minuta: K9N68_00120 Help Entry K9N68_00120       CDS       T07518                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kov  Kovacikia minuta Pathway kov01100   Metabolic pathways kov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K9N68_00120 (acpP)    00074 Mycolic acid biosynthesis     K9N68_00120 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K9N68_00120 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF6137 Motif Other DBs NCBI-ProteinID:  UBF26463 LinkDB All DBs Position 23316..23567 Genome browser AA seq 83 aa AA seqDB search MTETEIFDKVQKIVADQLGVDASEVTPQASFANDLGADSLDTVELVMALEEEFDIEIPDE AAEEIATVQSAVDYIGNKVTASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgagacagagatttttgacaaagttcagaagattgttgctgaccaactgggtgtt gatgccagcgaagtgacaccccaggccagctttgcgaacgatctgggagccgactccctg gatacggtggagctggtcatggcactggaagaggaatttgatatcgagatcccagacgaa gccgcagaagaaattgcgaccgtgcaatcagccgtagactatatcggcaataaagtcact gcgtctgcataa

DBGET integrated database retrieval system