Klebsiella michiganensis KCTC 1686: KOX_00895 Help Entry KOX_00895         CDS       T01681                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism kox  Klebsiella michiganensis KCTC 1686 Pathway kox01100   Metabolic pathways kox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KOX_00895    00074 Mycolic acid biosynthesis     KOX_00895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KOX_00895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AEX01924 UniProt:  A0A0H3H6Y9 LinkDB All DBs Position complement(193139..193390) Genome browser AA seq 83 aa AA seqDB search MTAYDEVLQKVCEMICDAKDLEPDEIDENTPLVRLKLDSLDYVELMVLAKREFNITLEAD WFIHNPGITLGELCQHISKESGN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgcctatgatgaagttctgcaaaaagtatgtgaaatgatttgcgatgcgaaagac ctggaaccggatgagattgatgagaatacgccgctggttcgactgaaattagatagcctg gactacgtcgagctcatggtgctggcaaaacgtgaattcaatatcaccctggaggcggac tggtttattcacaatccggggatcaccctgggcgaactgtgtcagcacatcagcaaagag tcaggtaactga

DBGET integrated database retrieval system