Klebsiella michiganensis KCTC 1686: KOX_04975 Help Entry KOX_04975         CDS       T01681                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism kox  Klebsiella michiganensis KCTC 1686 Pathway kox01100   Metabolic pathways kox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KOX_04975    00074 Mycolic acid biosynthesis     KOX_04975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KOX_04975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEX02732 UniProt:  A0A0H3H526 LinkDB All DBs Position 1027185..1027442 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLDELSVDDIETEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFIHAQRT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctgatcataaatacactgaacctggacgaa ctgtccgttgacgatatcgaaaccgaagcggcgctgtttggcgatggtttgggactggac tcaatcgatgctctggaactgggtctggcagtgaaaaaccagtacggtgtggtgctgtcc gccgagagtgaagagatgcgtcagcactttttctccgttgccacgctggcatctttcatt cacgcgcaacgtacctga

DBGET integrated database retrieval system