Klebsiella michiganensis KCTC 1686: KOX_10260 Help Entry KOX_10260         CDS       T01681                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism kox  Klebsiella michiganensis KCTC 1686 Pathway kox03030   DNA replication kox03430   Mismatch repair kox03440   Homologous recombination Brite KEGG Orthology (KO) [BR:kox00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     KOX_10260    03430 Mismatch repair     KOX_10260    03440 Homologous recombination     KOX_10260  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kox03032]     KOX_10260    03400 DNA repair and recombination proteins [BR:kox03400]     KOX_10260 Enzymes [BR:kox01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      KOX_10260 DNA replication proteins [BR:kox03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      KOX_10260 DNA repair and recombination proteins [BR:kox03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      KOX_10260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_III_psi CSTF_C Motif Other DBs NCBI-ProteinID:  AEX03778 UniProt:  A0A0H3H624 LinkDB All DBs Position 2187541..2187954 Genome browser AA seq 137 aa AA seqDB search MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPGHIRLVMVAEEPPSLTEPLISDILRA LALMPEQVMQLTPERVAMLPQDARCNSWRLGTDAPLLLAGAQLSTPAFDELQTSTPARMA LWQQICAHEHDFYPQSG NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgacatcccgacgagactggcaattacagcagctgggcatcacccagtggtcgctacgt cgtcctggggcgttacagggtgaaatcgctatctcgcttcctggacacattcgtctggtg atggtggcggaagaaccgccatcgctgaccgaaccgcttatcagcgatattctgcgcgcg ctggccctgatgccggagcaggtgatgcagctgacgcctgaacgcgttgcgatgctgcct caggacgcacgctgtaatagctggcggctcggcaccgacgcgccgctgctgctggcgggc gcacagctttccacgcccgcattcgatgaacttcagaccagcacgcctgctcgcatggcg ctctggcaacagatttgcgcacatgaacacgatttctaccctcaatccggctga

DBGET integrated database retrieval system