Klebsiella michiganensis HKOPL1: J415_03940 Help Entry J415_03940        CDS       T03188                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism koy  Klebsiella michiganensis HKOPL1 Brite KEGG Orthology (KO) [BR:koy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:koy03110]     J415_03940 Chaperones and folding catalysts [BR:koy03110]  Protein folding catalysts   Protein disulfide isomerase    J415_03940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR CLIC-like_N GST_N Motif Other DBs NCBI-ProteinID:  AHW86345 LinkDB All DBs Position 862275..862526 Genome browser AA seq 83 aa AA seqDB search MANIDIYTKATCPFCVRAKALLNSKGVTFNELPIDGDAAKREEMIQRSGRTTVPQIFIDA QHIGGCDDLYALDSRGGLDPLLR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatattgatatctataccaaagcgacctgcccgttctgcgtacgtgcaaaagcg ctgctgaacagcaagggcgtgacgttcaacgagttgcctatcgatggcgatgctgcgaag cgtgaagagatgattcagcgcagcggtcgaacgacggttccgcagatttttattgatgcg cagcacattggcggctgtgacgacttgtacgcgcttgattcacgtggtggactcgatccc ctcctgcgctaa

DBGET integrated database retrieval system