Klebsiella michiganensis HKOPL1: J415_08810 Help Entry J415_08810        CDS       T03188                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism koy  Klebsiella michiganensis HKOPL1 Pathway koy01100   Metabolic pathways koy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:koy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J415_08810    00074 Mycolic acid biosynthesis     J415_08810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J415_08810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AHW87297 LinkDB All DBs Position 1871044..1871295 Genome browser AA seq 83 aa AA seqDB search MTAYDEVLQKVCEMICDAKDLEPDEIDENTPLVRLKLDSLDYVELMVLAKREFNITLEAD WFIHNPGITLGELCQHISKESGN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgcctatgatgaagttctgcaaaaagtatgtgaaatgatttgcgatgcgaaagac ctggaaccggatgagattgatgagaatacgccgctggttcgactgaaattagatagcctg gactacgtcgagctcatggtgctggcaaaacgtgaattcaatatcaccctggaggcggac tggtttattcacaatccggggatcaccctgggcgaactgtgtcagcacatcagcaaagag tcaggtaactga

DBGET integrated database retrieval system