Kordiimonas sp. SCSIO 12610: KFF44_08400 Help Entry KFF44_08400       CDS       T08324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism koz  Kordiimonas sp. SCSIO 12610 Pathway koz01100   Metabolic pathways koz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:koz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KFF44_08400    00074 Mycolic acid biosynthesis     KFF44_08400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KFF44_08400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF5783 DUF5798 Motif Other DBs NCBI-ProteinID:  UTW53867 LinkDB All DBs Position 1830708..1830941 Genome browser AA seq 77 aa AA seqDB search MSDIADKVQKIVIEHLGVEEDKVTETASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA EKIQTVKDAIDFIGANS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgccgataaggtgcaaaaaattgttatcgaacacctaggtgtagaagaa gataaagtcaccgaaactgctagcttcatcgatgatcttggcgcagacagccttgataca gttgagctggttatggctttcgaagaagagtttggtattgaaattccagacgatgcagct gaaaaaattcagactgttaaggatgcgatcgattttatcggcgctaattcctaa

DBGET integrated database retrieval system