Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_01298 Help Entry KPNJ1_01298       CDS       T03176                                  Name (GenBank) SOS operon TUM protein   KO K12149   DNA-damage-inducible protein I Organism kpa  Klebsiella pneumoniae 30660/NJST258_1 Brite KEGG Orthology (KO) [BR:kpa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kpa03400]     KPNJ1_01298 DNA repair and recombination proteins [BR:kpa03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     KPNJ1_01298 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Rnk_N Motif Other DBs NCBI-ProteinID:  AHM83704 LinkDB All DBs Position 1245100..1245375 Genome browser AA seq 91 aa AA seqDB search MQPVNGHFQLRGISMRIEIMIDKEQKISQAILDALEAELYRNLQPIYPKTAIRIRKGSAN GVELSGLKLDEDKKRVMEIMQQVWEDDSWLH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcaaccggtcaatggacatttccagttaaggggaatctctatgcgaattgaaataatg atcgataaagagcagaagattagccaggcaatactggacgctctggaagctgaactttac cgaaatctccagccgatctatccaaagaccgcgatccgtattcgaaaaggttcggcaaac ggcgttgagctaagcggcttaaagctagatgaagacaaaaaacgagtgatggaaatcatg cagcaggtttgggaagacgacagctggctgcattaa

DBGET integrated database retrieval system