Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_03434 Help Entry KPNJ1_03434       CDS       T03176                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism kpa  Klebsiella pneumoniae 30660/NJST258_1 Pathway kpa01100   Metabolic pathways kpa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KPNJ1_03434    00074 Mycolic acid biosynthesis     KPNJ1_03434   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KPNJ1_03434 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AHM85840 LinkDB All DBs Position complement(3248685..3248921) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system