Keratinibaculum paraultunense: JL105_04940 Help Entry JL105_04940       CDS       T07032                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism kpar  Keratinibaculum paraultunense Pathway kpar00020   Citrate cycle (TCA cycle) kpar00720   Other carbon fixation pathways kpar01100   Metabolic pathways kpar01110   Biosynthesis of secondary metabolites kpar01120   Microbial metabolism in diverse environments kpar01200   Carbon metabolism kpar01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:kpar00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JL105_04940   09102 Energy metabolism    00720 Other carbon fixation pathways     JL105_04940 Enzymes [BR:kpar01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JL105_04940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_9 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_4 Fer4_16 Fer4_8 Fer4_17 Fer4_15 Fer4_22 Fer4_3 Fer4_13 Metallothi_Euk2 Motif Other DBs NCBI-ProteinID:  QQY80842 LinkDB All DBs Position 1002793..1002981 Genome browser AA seq 62 aa AA seqDB search MLKKLNLEKELCKGCGICVAFCPKNVLVLKQGKAEIKNLDDCIQCGQCELRCPDYAIYLG GI NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgttaaaaaagcttaatttagaaaaagaattgtgtaaaggttgtggaatatgtgttgcc ttctgtccgaagaatgttttagttttgaaacaaggtaaagcagaaataaaaaatctagac gattgtatacaatgtggtcaatgtgaattaaggtgtccagattacgctatttatttagga gggatataa

DBGET integrated database retrieval system