Klebsiella pasteurii: LUW96_00980 Help Entry LUW96_00980       CDS       T08655                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpas  Klebsiella pasteurii Pathway kpas01100   Metabolic pathways kpas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LUW96_00980    00074 Mycolic acid biosynthesis     LUW96_00980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LUW96_00980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UHC99666 LinkDB All DBs Position complement(193834..194085) Genome browser AA seq 83 aa AA seqDB search MIAYDDVLQKVCEMICDAKDLEPDEVDENTPLVRLKLDSLDYVELMVLAKREFNITLEAD WFIHNPGITLGELCQHISKESGS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgattgcctatgatgatgttctacaaaaagtgtgtgaaatgatttgcgatgcgaaagac ctggaaccggatgaggtggatgagaatacgccgctggttcggctgaagttggacagcctc gactacgtcgagctcatggtgctggcaaaacgtgaattcaatatcaccctggaggcggac tggtttattcacaatccagggataacgcttggcgaactctgccagcacatcagtaaagag tcaggcagctaa

DBGET integrated database retrieval system