Klebsiella pasteurii: LUW96_08110 Help Entry LUW96_08110       CDS       T08655                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpas  Klebsiella pasteurii Pathway kpas01100   Metabolic pathways kpas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LUW96_08110    00074 Mycolic acid biosynthesis     LUW96_08110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LUW96_08110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UHD00985 LinkDB All DBs Position 1698795..1699043 Genome browser AA seq 82 aa AA seqDB search MTQFDEVYRKVGEMLCDAKDLEMDELEPDMPLHKLKLDSLDYVELMVLAKKEFAVSVGAD LFIDHPNMTLRDLCQYLSEKSH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgcaatttgatgaagtttaccgcaaagttggcgagatgctgtgtgatgcgaaggat ctggagatggacgagctggaaccagatatgccgctacataagctgaagctcgacagcctg gactacgtggaattgatggtactggcaaagaaagagtttgctgtctccgttggcgccgat ctgtttattgatcatccgaacatgacgcttcgtgatttatgccaatacctcagcgaaaaa agccattaa

DBGET integrated database retrieval system