Klebsiella pasteurii: LUW96_17930 Help Entry LUW96_17930       CDS       T08655                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpas  Klebsiella pasteurii Pathway kpas01100   Metabolic pathways kpas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LUW96_17930 (acpP)    00074 Mycolic acid biosynthesis     LUW96_17930 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LUW96_17930 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  UHC97599 LinkDB All DBs Position 3801707..3801943 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactactgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system