Klebsiella pneumoniae blaNDM-1: FH42_01310 Help Entry FH42_01310        CDS       T03440                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpb  Klebsiella pneumoniae blaNDM-1 Pathway kpb01100   Metabolic pathways kpb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FH42_01310    00074 Mycolic acid biosynthesis     FH42_01310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FH42_01310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AIJ39378 UniProt:  W9BNY0 LinkDB All DBs Position 273222..273458 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system