Klebsiella pneumoniae blaNDM-1: FH42_19025 Help Entry FH42_19025        CDS       T03440                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism kpb  Klebsiella pneumoniae blaNDM-1 Brite KEGG Orthology (KO) [BR:kpb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:kpb03110]     FH42_19025 (groES)    03029 Mitochondrial biogenesis [BR:kpb03029]     FH42_19025 (groES) Chaperones and folding catalysts [BR:kpb03110]  Heat shock proteins   HSP10    FH42_19025 (groES) Mitochondrial biogenesis [BR:kpb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     FH42_19025 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AIJ42740 UniProt:  A0A0W8A5A2 LinkDB All DBs Position 3922072..3922365 Genome browser AA seq 97 aa AA seqDB search MSIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEIIAVGKGRILENGTVQPLDVK VGDIVIFNDGYGVKTEKIDNEEVLIMSESDILAIVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagtattcgtccgttacatgatcgtgtgatcgtcaaacgtaaagaagttgaaaccaaa tctgcgggcggcatcgttctgaccggttctgcagcagctaagtcaactcgtggcgaaatc atcgctgtcggtaaaggccgcatcctggaaaacgggaccgtgcagccgctggacgttaaa gttggtgacatcgtgattttcaacgatggctacggcgtgaagactgaaaagatcgacaac gaagaagtactgatcatgtccgaaagcgacatcctggcaattgttgaagcttaa

DBGET integrated database retrieval system