KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_05145
Entry
KPNIH10_05145     CDS       T03788                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KPNIH10_05145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpc02000]
    KPNIH10_05145
Enzymes [BR:kpc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     KPNIH10_05145
Transporters [BR:kpc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    KPNIH10_05145
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_30 KdpD AAA_16 MMR_HSR1 Cellulase AAA_22 MeaB nSTAND1
Other DBs
NCBI-ProteinID: AIA35336
LinkDB
Position
complement(1084691..1085533)
AA seq 280 aa
MNSSLAAVAETDFQPFTDPAAGRQRKVLSVRNLSKAYQAQHKVLDGISFDLHAGEMVGVI
GRSGAGKSTLLHVLNGTHSASGGEILSYPEVGTPHDVSQLKGRALNAWRSHCGMIFQDFC
LVPRLDVLTNVLLGRLSQTSTLKSLFKIFPAADRARAIALLEWMNMLPHALQRAENLSGG
QMQRVAICRALMQNPGILLADEPVASLDPKNTQRIMDVLREISEQGISVMVNLHSVELVR
AYCTRVIGVASGQLIFDDHPSRLTQDVLQRLYGDEVSQLH
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaacagctctcttgccgcggtggccgaaactgatttccagccgttcaccgatcccgct
gccggccggcagcggaaggtcttaagcgtgcgtaatctgagtaaagcttatcaagcccag
cacaaggtgctggacggcatcagctttgatctgcacgccggggaaatggtcggggtcatt
ggccgctccggcgccggtaaatcgacgctcctgcatgtcctcaacggcacccacagcgcc
agcggcggagaaattcttagctacccggaagtcggtaccccgcacgatgtctcacagctg
aaaggccgcgcgctcaatgcctggcgtagccactgcggaatgatttttcaggacttctgc
ctggtgccgcgcctcgacgtgctcaccaacgtcctgctgggccgcctcagccagacttca
accctgaaatcgctgtttaaaatctttcccgcagccgaccgggcgcgcgccattgcgctg
cttgagtggatgaacatgctgccgcacgcgctgcagcgggcggagaacctctccggcggg
cagatgcagcgggtggcgatctgccgggcgctgatgcaaaaccccgggatcctgctggcc
gacgagcctgtcgcctcgctggatccgaaaaacactcagcgcatcatggatgtgctgcgc
gagattagcgagcagggtatcagcgtgatggtaaacctgcattcggtggagctggtcagg
gcctactgcacccgggttatcggcgtcgccagcggccagcttatttttgacgatcacccc
tcccggctgacgcaggatgtgctgcagcggctgtacggcgatgaagttagccaattgcat
taa

DBGET integrated database retrieval system