KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_05275
Entry
KPNIH10_05275     CDS       T03788                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00430  Taurine and hypotaurine metabolism
kpc00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KPNIH10_05275 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KPNIH10_05275 (tauD)
Enzymes [BR:kpc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     KPNIH10_05275 (tauD)
SSDB
Motif
Pfam: TauD ArsA_ATPase
Other DBs
NCBI-ProteinID: AIA35361
LinkDB
Position
1110919..1111770
AA seq 283 aa
MSERLSITPLGPYIGAQVSGADLTRPLSDNQFEQLYHAVLRHQVVFLREQNITPAQQRDL
ALRFGDLHIHPVYPHAPGVEEIIVLDTHNDNPPDNDNWHTDVTFIDTPPAGAILAAKELP
MTGGDTLWTSGIAAWEALSEPFRQLLSGLHAEHDFRKSFQEYKYNKTEAEHRRWQEAVAK
HPPLLHPVVRTHPVTGKQALFVNEGFTTRIVEVSEKESAALLNFLFAHVTKPEFQVRWRW
QPNDVAIWDNRVTQHYANADYLPQRRIMHRATILGDKPYYRAG
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagtgaacgtctgagcattaccccgctggggccgtatattggcgcgcaggtgagcggg
gcggatttaacccgtccgctgagcgacaaccagtttgaacagctgtatcacgcggtgctg
cgtcatcaggtggtattcctgcgcgagcagaatatcaccccggcgcaacagcgcgacctg
gcgctgcggtttggcgacctgcatatccatccggtctaccctcatgccccaggtgtggag
gagattatcgtcctcgatacccacaacgataatccgccggataatgacaactggcatacc
gatgtcacctttatcgacacgccgcccgccggcgccattctggcggcgaaagagctgccg
atgaccggcggggacaccctgtggaccagcggcatcgccgcctgggaagcgctgtcagaa
cctttccggcagctgctgagcggcctgcatgccgaacacgatttccgcaaatcgttccag
gagtataagtacaacaagaccgaagccgagcatcggcgctggcaggaagcggtggcgaag
catccgccgctgctgcatccggtagtacgtacccacccggtgaccggcaagcaggcgctg
ttcgttaatgaaggctttaccacgcgaattgtcgaggtgagtgagaaagagagcgcagcg
ctgctgaacttcctgtttgctcatgtcactaaaccggagtttcaggtgcgctggcgctgg
cagccgaacgatgtcgctatctgggataaccgggtgacccagcattacgccaacgccgac
tatctgccgcagcggcggatcatgcaccgggcgacgatcctcggcgataagccgtattac
cgggcggggtaa

DBGET integrated database retrieval system