Kangiella profundi: CW740_12090 Help Entry CW740_12090       CDS       T05254                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpd  Kangiella profundi Pathway kpd01100   Metabolic pathways kpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CW740_12090    00074 Mycolic acid biosynthesis     CW740_12090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CW740_12090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUD79952 UniProt:  A0A2K9AQQ0 LinkDB All DBs Position 2587512..2587775 Genome browser AA seq 87 aa AA seqDB search MKSLETEIKEIIIDSLDLEDISIDDIETDEPLFGDGLGLDSIDALELGLAIKKQFNIKLD SDSEESKKHFYSVGTLASFIEQQRGAN NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaatccttagaaaccgagattaaagagatcattatcgattctcttgatcttgaagat attagcattgatgacatagaaactgatgagccattattcggcgacgggttaggtcttgat tccatcgatgcgcttgaattggggctggcaataaaaaagcaattcaatattaaactggat tctgactctgaagagtcaaaaaagcatttttattcagtaggtactcttgcttcgtttatt gaacaacaaagaggggctaactga

DBGET integrated database retrieval system