Kangiella profundi: CW740_12095 Help Entry CW740_12095       CDS       T05254                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpd  Kangiella profundi Pathway kpd01100   Metabolic pathways kpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CW740_12095    00074 Mycolic acid biosynthesis     CW740_12095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CW740_12095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AUD79953 UniProt:  A0A2K9AU59 LinkDB All DBs Position 2587775..2588032 Genome browser AA seq 85 aa AA seqDB search MAKFDTKDHIYQELVTILVDDFEVDGDDITLEANLYTDLDLDSIDTVDLVIKLQEMTGKS VNPETFKAVRTMQHVVDAVYDLVHN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctaaatttgataccaaggatcacatctatcaagagctggttaccattctggtcgac gattttgaagttgatggtgatgatattaccctcgaagctaatttatacactgaccttgat ttagacagcatcgatacggttgatctggtgattaagcttcaggaaatgacgggtaaatca gtcaatcctgagacctttaaagcggttcgtaccatgcagcatgtggttgatgcagtttat gatctagtccacaactga

DBGET integrated database retrieval system