Klebsiella variicola 342: KPK_3385 Help Entry KPK_3385          CDS       T00772                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism kpe  Klebsiella variicola 342 Brite KEGG Orthology (KO) [BR:kpe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kpe03400]     KPK_3385 DNA repair and recombination proteins [BR:kpe03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     KPK_3385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Bcr-Abl_Oligo Motif Other DBs NCBI-ProteinID:  ACI09823 UniProt:  B5XSK8 LinkDB All DBs Position complement(3413548..3413781) Genome browser AA seq 77 aa AA seqDB search MKVEITIDRQKKLPDGAVPALEKELLRRLDQNFNNCSLVIRRASSDGLTVLGGMDGDKKR VEEILQDTWESADDWFC NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaagtggaaatcacaattgatcgccaaaaaaaattgccggatggcgctgtgcctgct ctggagaaggagctactgcggcgattggatcaaaactttaataactgcagtcttgtgatt cgtcgggccagctctgatgggttgaccgtgcttggtggaatggacggagataaaaaacgt gtagaggaaatcctgcaggacacctgggaaagcgctgatgactggttttgttaa

DBGET integrated database retrieval system