Klebsiella variicola 342: KPK_3464 Help Entry KPK_3464          CDS       T00772                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpe  Klebsiella variicola 342 Pathway kpe01100   Metabolic pathways kpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KPK_3464 (acpP)    00074 Mycolic acid biosynthesis     KPK_3464 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KPK_3464 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ACI08211 UniProt:  B5XXH6 A0A087FQL6 LinkDB All DBs Position complement(3483917..3484153) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system