KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_09805
Entry
KPNIH24_09805     CDS       T03369                                 
Name
(GenBank) cell division protein DedD
  KO
K03749  DedD protein
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Brite
KEGG Orthology (KO) [BR:kph00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    KPNIH24_09805
SSDB
Motif
Pfam: SPOR LytR_C
Other DBs
NCBI-ProteinID: AID95512
LinkDB
Position
2022748..2023437
AA seq 229 aa
MASKFQNRLVGTIVLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPDMLPAAT
QALPSQPPEGAAEEVRAGDAAAPSLDPSRIPVNSNSFDDVQEPVVAAKPQPKPQPKPQPQ
QQAATPTPPPAKPQQQQPSQQQAALPAPTGKAYVVQLGALKNADKVNEIVGKLRASGFKV
YTSPSTPVQGKITRILVGPDASKDKLKGQLGDLQQISGLSGVVMGFTPN
NT seq 690 nt   +upstreamnt  +downstreamnt
gtggcgagtaagtttcagaaccgtttagtcgggacaatcgtgctggtggcgctgggggtg
attatcctgccagggctgctggacgggcagaaaaagcattaccaggatgagtttgccgcg
atcccgctggtaccgaaaccaggcgatcgcgatgaaccggatatgttgccggcggcaacc
caggcgttgccttcgcaaccgccggaaggggcggcggaagaggtgcgggcgggcgatgcc
gccgcgccatcgttagatccatcgcgtattccggtgaacagcaacagcttcgatgacgtt
caggagccggtggtggccgcgaaaccgcagcccaagccgcagccgaaaccgcagccgcaa
cagcaggccgcgacgccaacgccgccgccggctaagccacagcagcaacagccatcgcag
cagcaggcggccctgccggcgccgaccggcaaagcctatgtggttcagctgggcgcgttg
aagaacgccgataaggtgaatgagattgtcggtaaactgcgggcctcgggtttcaaagtc
tatacgtcgccttcgacgccggtacagggtaaaattacccgcatcctcgtcggcccggat
gcgtcaaaagacaagctgaaaggccagctgggcgatctgcagcagatttccgggcttagc
ggggtggtgatgggtttcaccccgaactga

DBGET integrated database retrieval system