KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_13615
Entry
KPNIH24_13615     CDS       T03369                                 
Name
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:kph00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KPNIH24_13615
Enzymes [BR:kph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPNIH24_13615
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-ProteinID: AID96240
LinkDB
Position
2835322..2835843
AA seq 173 aa
MQRCILAILSLAFCAGAQAVSEDVQLNLVTNQGVGQTIGSVKITETDRGLEFAPTLRALP
PGKHGFHIHAEGSCQPAMKEGKAVAAGAAGGHYDPQHTGKHEGPLGAGHLGDLPLLVVND
AGVADQPIIAPRLKTLAEVKGKALMVHVGGDNMADSPQPLGGGGERFACGVIK
NT seq 522 nt   +upstreamnt  +downstreamnt
atgcaacgatgtattctcgcgatcttatccctcgcattttgcgctggcgcacaggccgtt
agtgaagatgtgcaacttaatctcgtgaccaaccagggcgtcggtcagaccatcggcagc
gtcaaaatcaccgaaaccgaccgcggactcgagttcgcccccactctgcgggcgctaccg
ccgggcaagcacgggtttcatattcatgccgaaggcagctgccagccggcgatgaaagaa
ggtaaagccgtggccgccggggcggcgggcggacattacgatccgcagcataccggcaaa
cacgaagggccgttgggggccgggcatcttggcgacctgcccctgctggtggtcaacgat
gcgggcgtagccgaccagccgattattgctccgcgcctgaaaacgctggcggaggtgaaa
gggaaagcgctgatggtccacgtaggcggggataacatggccgacagtccgcagccgctg
ggcggcggcggcgaacggtttgcctgcggggtgattaagtag

DBGET integrated database retrieval system