Kibdelosporangium phytohabitans: AOZ06_06445 Help Entry AOZ06_06445       CDS       T04088                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism kphy  Kibdelosporangium phytohabitans Pathway kphy03430   Mismatch repair Brite KEGG Orthology (KO) [BR:kphy00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AOZ06_06445  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kphy03400]     AOZ06_06445 Enzymes [BR:kphy01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AOZ06_06445 DNA repair and recombination proteins [BR:kphy03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AOZ06_06445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S T2SSF YebU_pre-PUA_dom Motif Other DBs NCBI-ProteinID:  ALG06609 UniProt:  A0A0N9HTB9 LinkDB All DBs Position complement(1429975..1430184) Genome browser AA seq 69 aa AA seqDB search MSDEQLGYEQARDELADVVAKLEAGGLSLEDSLALWERGEALAKICDRHLAGARERVEAA LAAADKDTK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgagcgacgaacaactcggctacgagcaagcccgtgacgaactcgcggacgtggtggcg aaactggaagcgggcggcctgtccctggaggactcactcgccctgtgggaacgcggagaa gcactcgcgaagatctgcgaccgccacctcgcaggcgcacgcgaacgcgtagaggctgcc ctggccgcagccgacaaggacaccaagtag

DBGET integrated database retrieval system