Klebsiella pneumoniae CG43: D364_05670 Help Entry D364_05670        CDS       T02866                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpi  Klebsiella pneumoniae CG43 Pathway kpi01100   Metabolic pathways kpi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D364_05670 (acpP)    00074 Mycolic acid biosynthesis     D364_05670 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D364_05670 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AGX37328 LinkDB All DBs Position 1214625..1214861 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system