Pantoea piersonii: N5580_01940 Help Entry N5580_01940       CDS       T08710                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism kpie  Pantoea piersonii Pathway kpie02024   Quorum sensing kpie03018   RNA degradation Brite KEGG Orthology (KO) [BR:kpie00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     N5580_01940 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     N5580_01940 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:kpie03019]     N5580_01940 (hfq)    03036 Chromosome and associated proteins [BR:kpie03036]     N5580_01940 (hfq) Messenger RNA biogenesis [BR:kpie03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      N5580_01940 (hfq) Chromosome and associated proteins [BR:kpie03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     N5580_01940 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WBG91351 UniProt:  A0AAJ5QJK3 LinkDB All DBs Position 395919..396230 Genome browser AA seq 103 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSNNYHHGGSNASAQSQPQQDGDNAE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatcattacaagacccgtttttgaacgcactgcgtcgtgaacgtgtt ccggtttcgatttatttggtcaacggtatcaagctgcagggacaaattgagtctttcgat caattcgtgattttgttgaagaacacggtaagccagatggtttacaagcacgccatttct accgtggttccatcacgcccggtttctcaccacagcaacaatgctggtggcggcagcaat aactaccatcacggcggtagcaacgcttctgcacagtcgcagccacaacaagacggcgat aacgcggaataa

DBGET integrated database retrieval system