Pantoea piersonii: N5580_17515 Help Entry N5580_17515       CDS       T08710                                  Symbol ppiC Name (GenBank) peptidylprolyl isomerase PpiC   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism kpie  Pantoea piersonii Brite KEGG Orthology (KO) [BR:kpie00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:kpie03110]     N5580_17515 (ppiC) Enzymes [BR:kpie01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      N5580_17515 (ppiC) Chaperones and folding catalysts [BR:kpie03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     N5580_17515 (ppiC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 DUF7067 Motif Other DBs NCBI-ProteinID:  WBG90838 UniProt:  A0AAJ5QJS3 LinkDB All DBs Position 3690857..3691138 Genome browser AA seq 93 aa AA seqDB search MAKTAAALHILVKEEALAHELLAKLEKGASFQQLAKKHSTCPSGRNGGDLGEFRQGQMVP AFDKAVFTCPLLKPFGPVKTAFGYHIIKVLYRS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaaccgcggcggctttacacattctggtgaaagaggaagcgctggctcacgag ctgctggcgaagctggaaaagggcgccagttttcagcagctggcgaagaagcactctacc tgtccttccgggcgcaacggcggcgatttaggcgagtttcgacaaggccagatggtgccg gcctttgataaagcggtcttcacctgcccgctgctgaaaccttttgggccggtgaaaacc gcatttggttatcacatcattaaagtgctctaccgcagctga

DBGET integrated database retrieval system