Pantoea piersonii: N5580_17730 Help Entry N5580_17730       CDS       T08710                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism kpie  Pantoea piersonii Brite KEGG Orthology (KO) [BR:kpie00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:kpie03036]     N5580_17730 (zapB) Chromosome and associated proteins [BR:kpie03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     N5580_17730 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N PspA_IM30 Leu_zip DUF2968 ADIP Nuf2_DHR10-like YabA HAP1_N Seryl_tRNA_N T3SchapCesA UPF0242 DUF2004 DUF7491 Herpes_UL6 APG6_N bZIP_1 DUF3450 V_ATPase_I Motif Other DBs NCBI-ProteinID:  WBG90876 UniProt:  A0AAJ5U9E3 LinkDB All DBs Position complement(3743575..3743814) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNALRNEAQQAAGNQDSLVRENQQLKE EQHLWQDRLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtattcgagaaactggaagcgaaagtacagcaggcgattgataccatc accctgctgcagatggaaatcgaagagctgaaagagcagaacaacgcgctgagaaacgaa gcgcaacaggccgcgggcaatcaggactcgctggtgcgtgaaaatcagcagctaaaggaa gagcagcatctgtggcaggatcgcctgcgtgcactgctgggaaaaatggaagaggtgtaa

DBGET integrated database retrieval system