Klebsiella pneumoniae JM45: N559_1547
Help
Entry
N559_1547 CDS
T02799
Name
(GenBank) sporulation and cell division repeat protein
KO
K03749
DedD protein
Organism
kpj
Klebsiella pneumoniae JM45
Brite
KEGG Orthology (KO) [BR:
kpj00001
]
09190 Not Included in Pathway or Brite
09194 Poorly characterized
99996 General function prediction only
N559_1547
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SPOR
LytR_C
Motif
Other DBs
NCBI-ProteinID:
AGT23299
LinkDB
All DBs
Position
1563837..1564487
Genome browser
AA seq
216 aa
AA seq
DB search
MLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPDMLPAATQALPSQPPEGAAE
EVRAGDAAAPSLDPSRIPVNSNSFDDVQEPVVAAKPQPKPQPKPQPQQQAATPTPPPAKP
QQQQPSQQQAALPAPTGKAYVVQLGALKNADKVNEIVGKLRASGFKVYTSPSTPVQGKIT
RILVGPDASKDKLKGQLGDLQQISGLSGVVMGFTPN
NT seq
651 nt
NT seq
+upstream
nt +downstream
nt
gtgctggtggcgctgggggtgattatcctgccagggctgctggacgggcagaaaaagcat
taccaggatgagtttgccgcgatcccgctggtaccgaaaccaggcgatcgcgatgaaccg
gatatgttgccggcggcaacccaggcgttgccttcgcaaccgccggaaggggcggcggaa
gaggtgcgggcgggcgatgccgccgcgccatcgttagatccatcgcgtattccggtgaac
agcaacagcttcgatgacgttcaggagccggtggtggccgcgaaaccgcagcccaagccg
cagccgaaaccgcagccgcaacagcaggccgcgacgccaacgccgccgccggctaagcca
cagcagcaacagccatcgcagcagcaggcggccctgccggcgccgaccggcaaagcctat
gtggttcagctgggcgcgttgaagaacgccgataaggtgaatgagattgtcggtaaactg
cgggcctcgggtttcaaagtctatacgtcgccttcgacgccggtacagggtaaaattacc
cgcatcctcgtcggcccggatgcgtcaaaagacaagctgaaaggccagctgggcgatctg
cagcagatttccgggcttagcggggtggtgatgggtttcaccccgaactga
DBGET
integrated database retrieval system