Klebsiella pneumoniae JM45: N559_3216 Help Entry N559_3216         CDS       T02799                                  Name (GenBank) DNA-damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism kpj  Klebsiella pneumoniae JM45 Brite KEGG Orthology (KO) [BR:kpj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kpj03400]     N559_3216 DNA repair and recombination proteins [BR:kpj03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     N559_3216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AGT24876 LinkDB All DBs Position 3261660..3261911 Genome browser AA seq 83 aa AA seqDB search MRIEVSIAKTTALPNGALEALNNELSRRIAEQFPAIDSQVSVRYATGNQLSVFGALKEDK DRISEILQETWESADDWFVHDLS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaagtgtctatcgccaaaacgaccgccttacctaacggcgcgctggaagcg ctgaataacgaactctctcgccgtatcgccgagcaattcccggccatcgatagccaggtg agcgtccgctacgccaccggtaatcagctctcggtgtttggcgccctgaaagaagacaaa gaccggataagcgaaatcctgcaggaaacatgggaaagcgcggacgactggtttgtccac gatctctcctga

DBGET integrated database retrieval system