KEGG   Klebsiella variicola KP5-1: A593_15820
Entry
A593_15820        CDS       T03368                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A593_15820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpk02000]
    A593_15820
Enzymes [BR:kpk01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     A593_15820
Transporters [BR:kpk02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    A593_15820
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 KdpD AAA_30 MMR_HSR1 AAA_16 AAA_22 Cellulase nSTAND1
Other DBs
NCBI-ProteinID: AIE01933
UniProt: A0A0B7GFK3
LinkDB
Position
complement(3300548..3301390)
AA seq 280 aa
MNSSLAAVAETDFQPFTDLDAGLQRKVLSVRNLTKAYHAQHKVLDGISFDLHAGEMVGVI
GRSGAGKSTLLHVLNGTHSASGGEILSYPEVGMPHDVSKLKGRSLNAWRSQCGMIFQDFC
LVPRLDVLTNVLLGRLSQTSTLKSLFKIFPAADRARAIALLEWMNMLPHALQRAENLSGG
QMQRVAICRALMQNPGILLADEPVASLDPKNTQRIMDVLREISEQGISVMVNLHSVELVK
AYCTRVIGVASGQLIFDDHPSRLTQDVLQQLYGDEVSQLH
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaacagctctcttgccgcggtggccgaaactgatttccagccgttcaccgatctcgat
gccggcctgcagcggaaggtcttaagcgtgcgtaacctgactaaagcctatcatgctcag
cacaaggtgctggacggcatcagctttgacctgcacgccggtgaaatggtcggggtcatt
ggccgctccggcgccggcaaatcgacgctcctgcatgtccttaatggtacgcacagcgcc
agcggcggtgaaattcttagctatccggaagtcggtatgccacacgatgtctcaaagctg
aaaggccgctcactcaacgcctggcgcagtcagtgcgggatgatctttcaggacttctgc
ctggtaccgcgcctcgacgtgctcaccaacgtcctgcttggccgcctcagccagacctca
accctgaagtcgctgtttaagattttccccgccgccgaccgggcgcgcgccattgcgctg
ctcgaatggatgaacatgctgccgcacgcgctgcagcgggcggagaatctctccggggga
cagatgcagcgggtggcaatctgccgggcgctgatgcaaaaccccggcattttgctggcc
gacgaacctgtcgcctcgctggatccgaaaaacacccagcgcatcatggatgtgctgcgc
gagattagcgagcagggcatcagcgtgatggtaaacctgcattcggtagagctggtgaag
gcctactgcacccgggttatcggcgtcgccagcggccagcttatttttgacgatcacccc
tcccggctgacgcaggatgtgctgcagcagctgtacggcgatgaagttagccaattgcat
taa

DBGET integrated database retrieval system