KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_10520
Entry
KPHS_10520        CDS       T01733                                 
Name
(RefSeq) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00430  Taurine and hypotaurine metabolism
kpm00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KPHS_10520
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KPHS_10520
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     KPHS_10520
SSDB
Motif
Pfam: TauD ArsA_ATPase
Other DBs
NCBI-GeneID: 11846050
NCBI-ProteinID: YP_005225352
UniProt: A0A0H3GIY0
LinkDB
Position
1110293..1111144
AA seq 283 aa
MSERLSITPLGPYIGAQVSGADLTRPLSDNQFEQLYHAVLRHQVVFLREQNITPAQQRDL
ALRFGDLHIHPVYPHAPGVEEIIVLDTHNDNPPDNDNWHTDVTFIDTPPAGAILAAKELP
MTGGDTLWTSGIAAWEALSEPFRQLLSGLHAEHDFRKSFQEYKYNKTEAEHRRWQEAVAK
HPPLLHPVVRTHPVTGKQALFVNEGFTTRIVEVSEKESAALLNFLFAHVTKPEFQVRWRW
QPNDVAIWDNRVTQHYANADYLPQRRIMHRATILGDKPYYRAG
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagtgaacgtctgagcattaccccgctggggccgtatattggcgcgcaggtgagcggg
gcggatttaacccgtccgctgagcgacaaccagtttgaacagctgtatcacgcggtgctg
cgtcatcaggtggtattcctgcgcgagcagaatatcaccccggcgcaacagcgcgacctg
gcgctgcggtttggcgacctgcatatccatccggtctaccctcatgccccaggtgtggag
gagattatcgtcctcgatacccacaacgataatccgccggataatgacaactggcatacc
gatgtcacctttatcgacacgccgcccgccggcgccattctggcggcgaaagagctgccg
atgaccggcggggacaccctgtggaccagcggcatcgccgcctgggaagcgctgtcagaa
cctttccggcagctgctgagcggcctgcatgccgaacacgatttccgcaaatcgttccag
gagtataagtacaacaagaccgaagccgagcatcggcgctggcaggaagcggtggcgaag
catccgccgctgctgcatccggtagtacgtacccacccggtgaccggcaagcaggcgctg
ttcgttaatgaaggctttaccacgcgaattgtcgaggtgagtgagaaagagagcgcagcg
ctgctgaacttcctgtttgctcatgtcactaaaccggagtttcaggtgcgctggcgctgg
cagccgaacgatgtcgctatctgggataaccgggtgacccagcattacgccaacgccgac
tatctgccgcagcggcggatcatgcaccgggcgacgatcctcggcgataagccgtattac
cgggcggggtaa

DBGET integrated database retrieval system