Klebsiella pneumoniae 32192: KU54_016300 Help Entry KU54_016300       CDS       T03746                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpne  Klebsiella pneumoniae 32192 Pathway kpne01100   Metabolic pathways kpne01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpne00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KU54_016300    00074 Mycolic acid biosynthesis     KU54_016300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KU54_016300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AJB58268 UniProt:  W9BNY0 LinkDB All DBs Position complement(3215923..3216159) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system