Klebsiella pneumoniae 34618: LI86_16610 Help Entry LI86_16610        CDS       T03747                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpnu  Klebsiella pneumoniae 34618 Pathway kpnu01100   Metabolic pathways kpnu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpnu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LI86_16610    00074 Mycolic acid biosynthesis     LI86_16610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LI86_16610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AJB76795 UniProt:  W9BNY0 LinkDB All DBs Position complement(3273915..3274151) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system