KEGG   Klebsiella pneumoniae 34618: LI86_19060
Entry
LI86_19060        CDS       T03747                                 
Name
(GenBank) enterobactin exporter EntS
  KO
K08225  MFS transporter, ENTS family, enterobactin (siderophore) exporter
Organism
kpnu  Klebsiella pneumoniae 34618
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpnu02000]
    LI86_19060
Transporters [BR:kpnu02000]
 Major facilitator superfamily (MFS)
  Metal transporters
   Enterobactin (siderophore) exporter (EntS) family [TC:2.A.1.38]
    LI86_19060
SSDB
Motif
Pfam: MFS_1 MFS_3 PTR2
Other DBs
NCBI-ProteinID: AJB77244
UniProt: W9BF22
LinkDB
Position
complement(3777372..3778613)
AA seq 413 aa
MNRQSWLLNLSLLKTHPAFRAVFIARFISILSLGLLGVAIPVQIQMMTHSTWQVGLSVTL
TGASMFVGLMVGGVLADRYERKRLILLARGTCGVGFVGLCLNALLPEPSLAAIYLLGIWD
GFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISPMIGGLLLATGGVAWNFG
LAAAGTFITTLTLLRLPQLPPPPQPREHPLRSLLAGLTFLCRSPLIGGIALLGGLLTMAS
AVRVLYPALAGSWQMSAGQIGLLYAAIPLGAALGALTSGQLAQTVRPGALMLATTVGSFV
AIALFSLMPHWALGALCLALFGWLSAISSLLQYTLIQTQTPEHMLGRINGLWTAQNVTGD
AIGAALLGGLGAVMTPAASASASGWALALVGVLLVGLLRELRRFQRPEIVNES
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaaccgacaatcctggctgctcaatctcagcctgctgaaaactcacccggcgtttcgc
gccgtttttatcgctcgctttatctctattctgtcgcttggcctgctgggcgtggccatt
ccggtgcagatccagatgatgacccattcgacctggcaggtcgggctgtcggtgacgctg
accggggcgtcgatgtttgttggtctgatggtggggggcgtgctggctgaccgctatgaa
cgtaaacgcctgatcctgctggcgcgcggcacctgcggcgtgggctttgtcggcctgtgt
ctgaacgccctgctgccggagccgtcgctggcggcgatctacctgctggggatctgggac
gggttcttcgcctcgttgggggtgaccgcgctgctggcggcgaccccggcgctggtggga
cgggaaaacctgatgcaggccggggccatcactatgttgacggtgcgcctgggctcggtg
atttcgccgatgatcggcggcctgctgctggccaccggcggcgtggcctggaactttggc
ctggcggcggcggggacctttatcaccaccttaaccctgctgcgtctgccgcagctgccg
ccgcctccgcagccgcgcgagcatccgctgcgctccctgctggcggggctgaccttcctc
tgccggagcccgcttatcggcgggattgcgctgcttggcggtctgctgaccatggccagc
gcggtgcgggtgctctatccggcgctggccggtagctggcagatgtcggccggacagatt
ggcctgctgtacgccgctattccgctcggtgcggcgctgggggcgttgaccagcggccag
ctggcccagacggtgcggccgggcgcgctgatgctggcgacgacggtgggatcgtttgtc
gccattgcgctgttcagcctgatgccgcactgggcattgggcgcgctgtgcctggcgctg
tttggctggctgagcgctattagctcgctgctgcagtacaccctgattcagacccagacg
ccggaacatatgctcgggcggattaacggtctgtggaccgcgcaaaacgtcaccggcgac
gccatcggcgcggcgctgctcggcggcttaggggcggtaatgacgccggcggcatccgcc
agcgccagcggctgggcgctggcgcttgtcggtgtgctgctggttgggctgctacgcgag
ctgcgccgtttccagcgcccggaaattgtcaacgaaagttaa

DBGET integrated database retrieval system