KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_07775
Entry
KPN2242_07775     CDS       T01982                                 
Name
(GenBank) lipid transporter ATP-binding/permease protein
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KPN2242_07775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpo02000]
    KPN2242_07775
Enzymes [BR:kpo01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     KPN2242_07775
Transporters [BR:kpo02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    KPN2242_07775
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 Zeta_toxin DEAD AAA_22 DUF87 APS_kinase AAA_29 AAA_15 AAA_25 nSTAND3 AAA_18 RsgA_GTPase ABC_membrane_2 AAA_30 HUTI_composite_bact AAA NB-ARC MMR_HSR1 AAA_24
Other DBs
NCBI-ProteinID: AEJ97473
LinkDB
Position
1645152..1646900
AA seq 582 aa
MQNDKDLSTWQTFRRLWPIIAPFKAGLIVAAVALVLNAGSDTFMLSLLKPLLDDGFGKTD
RSVLLWMPLVVIGLMVLRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS
TGTLLSRITYDSEQVASSSSSALITVVREGASIIGLFVMMFYYSWQLSLILIVLAPIVSV
AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLMFGGQEVETKRFDKVSNKMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDTLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFAILDSEQEKDEGTRVIERAKGNLKFENVTFTYPGREVAALR
NINLDIPEGKTVALVGRSGSGKSTIASLITRFYDVDEGQILLDGHDLREYKLSSLRDQVA
LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVM
LSGGQRQRIAIARALLRNSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEQADEIVVVEDGRIVERGTHHDLLEHKGVYAQLHKMQFGE
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcagaacgataaagatctctccacgtggcagaccttccgccgactttggccgattatc
gcgccgtttaaagccgggctaatcgtagcggcggtggcgttggtgcttaacgcgggcagt
gacaccttcatgttatcgcttcttaaaccgttattggatgatggttttggtaaaacggat
cgctcagtgctgctatggatgccgctggtggttatcggcctgatggtgctgcgtgggatc
accagctacatctcgagctattgtatttcctgggtttccggcaaagtggtgatgaccatg
cgtcgtcgcctgttcggccacatgatgggtatgccggtggccttctttgacaagcagtct
accggaacgctgctgtcacgcatcacctatgattctgagcaggtcgcctcctcttcttcc
agcgcgctgatcaccgtggtccgcgaaggagcatcgattatcggtctgttcgtgatgatg
ttctattacagctggcagctgtcgctgatcctgatcgtactggcgccgattgtgtcggtg
gcgatccgcgtggtctccaagcgttttcgcaatatcagtaagaatatgcagaacacgatg
gggcaggtcaccaccagcgccgagcagatgctgaaagggcacaaagaggtgctgatgttt
ggcggccaggaagtggaaaccaaacgttttgataaagtcagcaataaaatgcgtctgcag
gggatgaagatggtttccgcctcgtctatctccgacccgatcattcagcttatcgcctcc
ctggcgctggcctttgtcctgtatgccgccagcttcccgagcgtgatggacaccctgacc
gccgggaccattaccgtggtcttctcctcgatgattgcgctgatgcgtccgctgaagtcg
ctgaccaacgtcaatgcccagttccagcgtgggatggcggcgtgccagacgctgtttgcg
atcctcgattccgagcaggaaaaagacgaaggtacgcgggtcattgagcgggcgaaaggc
aatctcaagttcgagaacgtcacctttacctacccgggtcgcgaagtggccgcgctgcgc
aatatcaatctcgatatcccggaagggaaaacagtggcgctggtggggcgctcagggtcg
ggtaaatcgaccattgccagcctgatcacccgcttctacgatgtcgacgaggggcagatc
ctgctggatggccacgacctgcgcgagtacaagctgagctcgctgcgcgaccaggtggcg
ctggtttcacaaaacgtgcatctgttcaacgataccgtcgccaacaatatcgcctatgcc
cgtaccgaagagtacagccgcgagcagattgaagaggccgcgcgcatggcctacgccatg
gatttcatcaacaagatggataatggtctggataccatcatcggcgagaatggcgtgatg
ctgtccggcggccagcgccagcgtattgctattgcccgcgcgctgctgcgtaacagcccg
atcctgatcctcgatgaagctacctcggcgctggataccgagtccgagcgtgccattcag
gcggcgctggatgagctgcagaaaaaccgtacctcgctggttatcgctcaccgtctgtcg
accattgagcaggctgatgaaatcgtggtggttgaagacgggcggatcgtggagcgcgga
acgcaccatgacctgctggagcataagggcgtgtacgcccagctgcataagatgcaattc
ggcgaatga

DBGET integrated database retrieval system