Kingella potus: LVJ84_12890 Help Entry LVJ84_12890       CDS       T08248                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpot  Kingella potus Pathway kpot01100   Metabolic pathways kpot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ84_12890    00074 Mycolic acid biosynthesis     LVJ84_12890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ84_12890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 FitA-like_RHH DUF1493 Motif Other DBs NCBI-ProteinID:  UOP01930 LinkDB All DBs Position 2166516..2166773 Genome browser AA seq 85 aa AA seqDB search MSEAEIRSLLADTLVSLFEIEPERIRPDTNLYEDLEIDSIDAIDLIDSIKRETGRKLNAE DFRNVRTVDDVVKAVLNVQAAAQAE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ctgagcgaagccgaaatccgcagcctgcttgccgacacgctggtcagcctgtttgaaata gaacccgagcgcatccgccccgacaccaacctgtatgaagatttggaaatcgacagcata gacgcgattgacctcatcgacagcatcaaacgcgaaacagggcgcaagctcaacgccgaa gacttccgcaacgtacgcaccgtggacgatgtggtcaaagcggtgttgaacgtgcaggcg gcggcgcaagccgaataa

DBGET integrated database retrieval system